DPCstruct | MC44275
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 223 ± 22 aa |
| Standard deviation of domain lengths | 21.51 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14700 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P8AP43 | 55-303 | LVPITAFQYDLVAPILRSVHRKFVKKLGIDETRMWSDIFADYVALFDNDEVARLHTHREWWVKCCRRTGIHPSYQIYFEDIHTEARN… |
| A0A0D8XK61 | 1-243 | MWAMVFADYARLFDNDDIARSYTHREWWVKCCRRFGIHPSYRIFFEDFHIETRREVATFITQVVLDACKFPVVDKEKTEMIDAFSIR… |
| M0ZLT1 | 245-435 | None |
| A9V1Q0 | 86-326 | None |
| A0A183KQW7 | 100-345 | None |
| A0A821A418 | 149-348 | None |
| A0A453T4C4 | 33-225 | None |
| H2Y3Q0 | 1-235 | None |
| A0A1I7USX8 | 391-607 | None |
| A0A368GKU3 | 440-654 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.