DPCstruct | MC4427
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 182 ± 23 aa |
| Standard deviation of domain lengths | 23.43 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 30.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09773 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F1L820 | 102-295 | SRFALNSFLYLTIAAVQWVFHVLIIERILVDPFHSMIDLCSIANISVLSLTHPLYGYYIHGRSVHGRADTDMAHMNQYLQNERDNLC… |
| A0A3P7HBI6 | 25-177 | IVERILIDPFHNIIDLCSIANISVLSLTHPLYGYYIHGRSVHGRADTDMLHMNQYLQNERDNLCGQRGLEPGSELQTFAVSLPKAFR… |
| A2FR54 | 559-746 | None |
| A0A816WKB6 | 183-372 | None |
| A0A3Q0J5U7 | 226-418 | None |
| A0A7S0MGX5 | 329-530 | None |
| T1KY17 | 832-1025 | None |
| A0A5J4VSP6 | 37-212 | None |
| A0A0B1TQ51 | 215-377 | None |
| A0A2G9S482 | 2-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.