DPCstruct | MC44268
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 414 ± 80 aa |
| Standard deviation of domain lengths | 80.28 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 76.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 34.40 |
| Pfam Score | 50.00 |
| Assigned Pfam label(s) | PF00476- PF18136 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D8XCM2 | 100-475 | EVKLDAWLFDVDWSVRSANEYPEWYFKLFSKRGKAYYDIGCLTSEDVIMKSALVPLIFGMTYGPYPLHRTQDLGWGYLVPCTQDILE… |
| C4YCA9 | 56-445 | FAALKSLGSLVLPTTKKWNNYIESAEKVYDENRNAVSSILKERANELIRFIEEQNDSLKPDYESDPWLKQLNWTLKAQRLKKDGSPY… |
| C9SPL1 | 223-668 | None |
| T1GMA0 | 163-520 | None |
| A0A1Z5T4U4 | 32-401 | None |
| H0EXW0 | 46-397 | None |
| A0A4R8QLL7 | 2-517 | None |
| A0A1I7XB20 | 1-501 | None |
| A0A2A2LQQ5 | 10-590 | None |
| W2TYG9 | 2-342 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.