DPCstruct | MC44267
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 522 ± 75 aa |
| Standard deviation of domain lengths | 75.21 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 75.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 37.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183V7L4 | 220-701 | LIEFQKKFALLSLEEDGRCLLRAVDVPSNIPRKLLCSKTVKTASSTDLHVIASDDYYAVTSNGFPSAGEVNVSKREDVTFLKDAPHN… |
| A0A0D8XAL9 | 9-522 | CDPTHRIGFFKAQEFIKHYAVKPATVQNDSYYILCNENDNWNSRPVETNFTAKIDRLFVHDNSVILSADSFYYLKSSGFPLRLRTND… |
| Q19346 | 1257-1752 | None |
| A0A3M7S582 | 39-462 | None |
| A0A7S2S540 | 273-802 | None |
| A0A5N5SPY1 | 209-887 | None |
| A0A6A1Q3H8 | 193-815 | None |
| A0A4Z2IMY5 | 71-547 | None |
| A0A7J7JYV6 | 1-477 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.