DPCstruct | MC44265
Metacluster Properties and Pfam Annotations
| Number of structural domains | 66 |
|---|---|
| Mean domain length (aa) | 88 ± 8 aa |
| Standard deviation of domain lengths | 8.43 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 35.20 |
| Pfam Score | 99.06 |
| Assigned Pfam label(s) | PF14813- PF06645 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834T3M4 | 161-247 | EMDWQGQKLAEQLMQIMLLAFAVVAFAAGYIMASFQMMILIYAGGVVLTTLVTVPNWPLFNRHPLKWLDPSEVEKHPKPQQSVNVNS |
| A0A7R7XW83 | 6-86 | SPIQDALEGQIDFHGQQITEIFSTALLVVSGVVASLIGYIFQDIHLSLWAGLAGTLLTALIIIPPWPIYNKHPEKWLVPFS |
| A0A182F9K6 | 27-120 | None |
| A0A0V0QRB6 | 23-117 | None |
| A0A2I3BQG3 | 1-89 | None |
| A0A7M5X8S6 | 17-102 | None |
| U6KW30 | 1-100 | None |
| A0A4W3IBN5 | 6-95 | None |
| A0A835MY75 | 447-529 | None |
| A0A6P3D9Q9 | 9-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.