DPCstruct | MC44262
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 266 ± 29 aa |
| Standard deviation of domain lengths | 28.79 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 75.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 21.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A383W1F6 | 2-272 | QLAEPTTPAPAAAAANAAKADAAAPPTPLEQRQWQRLAQRAVRLAVTAFKDGCTRCADASARGTAEATQLTNSLLSQRYMPDLKLPE… |
| A0A834SP16 | 96-402 | SSPSRTSDSKPQNLNSTSSPLAPSVLRLWRPAAQRNLRNQWPKLASYRQQWTSISSCGRSHATALVNAHLSQRYMPNMELGVLSDMP… |
| A0A7S0QUW7 | 3-252 | None |
| A0A1Y2GFK4 | 3-303 | None |
| A0A6A2Y5Q3 | 2-236 | None |
| A0A7S0PR42 | 1-244 | None |
| A0A7S0VBF9 | 9-226 | None |
| D8SZU5 | 7-251 | None |
| A0A835WGQ2 | 153-466 | None |
| A0A4D8Y8A8 | 24-294 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.