DPCstruct | MC44261
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 103 ± 6 aa |
| Standard deviation of domain lengths | 5.87 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 49.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G2W8M4 | 111-221 | QGLERTGFGAALTGDDLEGLGFFTCHADLEDELIRALGTDGVQRVIDAQGDLRALHIFRKQPAQRERPVEAQLRRFMGTIGGRKEHY… |
| A9WVK8 | 1-112 | MRAAERAGLGVRLSRTEMEALGFWVCEADLEEELMRTLGVAVVESVIEAHGDLRALTIFRKQPAQLACTEQQRLHRFMGTISGRKIN… |
| L1KRF5 | 34-134 | None |
| A0A7W0PT86 | 1-100 | None |
| A0A5B8BZN6 | 384-492 | None |
| A0A7M1SRP9 | 99-195 | None |
| A0A0Q8W182 | 5-108 | None |
| A0A2T7JCQ7 | 252-354 | None |
| A0A1H0XQS6 | 86-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.