DPCstruct | MC4426
Metacluster Properties and Pfam Annotations
| Number of structural domains | 133 |
|---|---|
| Mean domain length (aa) | 266 ± 50 aa |
| Standard deviation of domain lengths | 50.06 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 87.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 24.91 |
| Pfam Score | 97.66 |
| Assigned Pfam label(s) | PF16484- CL0149- PF05760 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F7E6D9 | 429-725 | DSLPPLPVPSLEESLKKYLDSVKPFATNEEYQRTQEIVAKFHRGIGQALHQKLLERAKGKRNWLEEWWLNVAYLDVRIPSQLNVNFA… |
| A0A3P7H090 | 28-268 | PVRQFYEVVQGGYKCPRCGGREQVGLNTTNTMKHLKARHETEYAELVEALSHRKQPLEQWWYDAYNEIRSPLAPFLSLASVNQRFAP… |
| D6W820 | 37-373 | None |
| A0A5J5CBD6 | 261-574 | None |
| A0A5J5CWP0 | 23-298 | None |
| A0A1V6TPB7 | 272-564 | None |
| A0A817PKP6 | 450-728 | None |
| E7FA20 | 4-301 | None |
| A0A4Y2U3B2 | 8-235 | None |
| A0A819TAP7 | 43-312 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.