DPCstruct | MC44258
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 101 ± 13 aa |
| Standard deviation of domain lengths | 13.12 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 47.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S2TCX6 | 28-131 | HPGAVPEDERDALLGQKWKSSQDVAWTTSSDANGFHLLTAAGSGGYAWKNLATLAEPGFDADSWIGNACVTGTGRYAVVVYAPRTFT… |
| A0A1Q4XD30 | 3-86 | GGGWERSTDRAVTTAGDSTGFHVLVAEARNGYQWRTAASLSELGFDTDAWIGNACVTASGDRAVVAYAPRTFTNEAVLNDRGAF |
| R1I5M4 | 23-131 | None |
| A0A6B1LE07 | 42-148 | None |
| A0A1Q5LZP3 | 1-109 | None |
| A0A399UT31 | 74-150 | None |
| A0A1H2JKQ5 | 30-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.