DPCstruct | MC44257
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 135 ± 16 aa |
| Standard deviation of domain lengths | 15.63 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 89.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 51.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0030 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A9WQL2 | 1-131 | MTVMGGLWAISTGLMAWAMAAASALGSLGEGFEQRFGPAASSLFASATTLTSTGAVDVAHDSLPPLAGGMALLNMMLGEIAPGGVGS… |
| A0A527I4I9 | 71-182 | ILASMGVLFLVGVIVCYWAEAAGSPLVHALGIDGGNMEGKETRFGIALSALFAVITTAASCGAVNAMHDSFTALGGMIPLINMQLGE… |
| A0A0P0LB15 | 2-137 | None |
| A0A6G3V984 | 16-161 | None |
| A0A1E1VVB2 | 67-197 | None |
| A0A447XBT0 | 1-114 | None |
| V6I0F5 | 34-148 | None |
| A0A534N902 | 567-719 | None |
| A0A7X7Z1F1 | 165-322 | None |
| A0A1V4TRG9 | 534-692 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.