DPCstruct | MC4424
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 82 ± 4 aa |
| Standard deviation of domain lengths | 3.81 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 76.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 60.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0561 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P7GGH2 | 1-83 | MSIEIESADVIRLIQQYLKESNLFRTLHTLQEETGVTLNTVDSVDGFCADINNGHWDTVLKAIQSLKLPDKKLIDLYEQIVLE |
| A0A183VHE0 | 1-85 | MTSIEIEASDVVRLVEQYLKENNLMRTLAVLQEETNITLNTVDSIDSFVHEIQSGHWDTVLKVIQPLKLPAKKLIDLYEQVSMSS |
| A0A2G8LJF6 | 1-84 | None |
| A0A1Y3EKF8 | 444-522 | None |
| A0A482S4X3 | 1-89 | None |
| A0A0N5AU80 | 1-84 | None |
| A0A498NBX9 | 210-282 | None |
| A0A6L5CC05 | 1-83 | None |
| A0A6G0V1U2 | 573-651 | None |
| A0A150FYG8 | 68-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.