DPCstruct | MC44237
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 105 ± 11 aa |
| Standard deviation of domain lengths | 11.11 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q0YSC6 | 3-113 | IDRLSQFALALFITIFSISSYANSESEVLLGLNQTPKTIDIRVATGGCTQKEDFKIDVKKGLTEKSPYSITIYRIKNDYCKAYLPEG… |
| A0A3B9HP72 | 21-113 | ASAQVREIPEPLLGIELDGNDFRITIAQKGGTFKHSFRFDVRKSGEEQFVTVVRISRDECKMVPQREVLTFTAEEVGVDPRKPVFIS… |
| A0A5C6QTV1 | 14-127 | None |
| A0A1H3XNR8 | 7-129 | None |
| A0A1F3VR13 | 3-98 | None |
| A0A1E4AQ62 | 2-97 | None |
| A0A3P3XQH1 | 222-336 | None |
| A0A2E3VWJ6 | 66-145 | None |
| A0A357KPX3 | 45-159 | None |
| A0A7X8YV89 | 14-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.