DPCstruct | MC44234
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 102 ± 9 aa |
| Standard deviation of domain lengths | 8.53 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 77.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 34.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L6QES4 | 763-863 | NVSHYLKSCNGQGSTSVPILVPVSSSNHHVELNMRSQSKNARYALMTLADEMSDKRKITEPVVRKNFKVIVLYGVDKVSENNQRLIK… |
| A0A4Y2NVQ1 | 66-164 | EKLRIEHQIFETPSKRKVEVITIASNYHIEVNPSDVGIYDRVVIQELLKTVAQTHQLDSHTQKEFKVVVLMEVDKLTKDAQHALRRT… |
| A0A6D2I507 | 547-648 | None |
| I1BJ69 | 1-82 | None |
| A0A445B1P3 | 322-423 | None |
| A0A2H9TGK5 | 435-547 | None |
| A0A1R3JER1 | 16-125 | None |
| A0A2Z6RLB2 | 66-163 | None |
| U6MAC2 | 65-185 | None |
| A0A7J6LE26 | 510-607 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.