DPCstruct | MC44233
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 68 ± 6 aa |
| Standard deviation of domain lengths | 6.17 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 63.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0680 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1EHL2 | 1-65 | FKKPATFADCGDHELPFGWEKVRDVHGDVGVYYVNHHKKTTQIEDPRIQWKREQERMLREYLENA |
| A0A2T7PLE8 | 46-112 | KPETFADCVGDELPLGWEEVNDPKLGTYYIDHINQVNQLEDPRLQWRQEQELMLKEYLVTAQDDLKA |
| L8Y673 | 155-232 | None |
| T1GEU1 | 1-77 | None |
| A0A154NY71 | 44-111 | None |
| A0A7R9L0N5 | 208-285 | None |
| S4RLV5 | 1-66 | None |
| A0A4S2KAZ0 | 44-113 | None |
| A0A671WGY4 | 50-113 | None |
| A0A1A8AU71 | 50-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.