DPCstruct | MC44231
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 181 ± 17 aa |
| Standard deviation of domain lengths | 17.08 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 26.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L9VL22 | 2-192 | RDLDAGLLLNPFTFLAHRHHFPTKLEPEHRWEPLDQVLCRWLALWDRGKYYWDDELQYPLVRPWVEQDLIESLAAWDGLLSSIVKRL… |
| A0A094BLQ2 | 516-717 | LNYDQEISRAIFHCDILDSHITMNGRTSWDPLEVVLSAWLDMIDTGKVVARSPSIKGPCEAAPWEMVPYSLHDLQMALNGFDNLVFR… |
| A0A0P7BI59 | 368-539 | None |
| A0A4Q4ZGP3 | 116-309 | None |
| A0A4S8MGE2 | 262-464 | None |
| A0A094FJ43 | 136-291 | None |
| A0A6G1FW63 | 74-250 | None |
| A0A4S8LFW6 | 97-264 | None |
| A0A6A6TWT7 | 174-361 | None |
| A0A4Q4M4K6 | 593-782 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.