DPCstruct | MC44227
Metacluster Properties and Pfam Annotations
| Number of structural domains | 121 |
|---|---|
| Mean domain length (aa) | 319 ± 78 aa |
| Standard deviation of domain lengths | 78.10 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 80.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 22.81 |
| Pfam Score | 80.53 |
| Assigned Pfam label(s) | PF04560- PF04997- CL0410- PF04983- PF00623 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P7I0W8 | 8-408 | KEIGKISFGLMDPETYRDMSATKVITADTYDDDGYPIDMGLMDPRLGVIDPGLECRTCGQHSGSCNGHFGHIELAAPVIHVGFAKLI… |
| A0A5S9M380 | 1-235 | MGHIELAAPVSHIWYFKGIPSRMGLVLDMSPRALEEVIYFASYVVTDPGNTPLEKKQLLSEKEFRAYLDKYGNTFQAAMGAEAINKL… |
| A0A7S0MHA2 | 4-199 | None |
| A0A4Z2HLZ3 | 2-386 | None |
| A0A3R6IGC9 | 67-272 | None |
| A0A834SQQ6 | 18-341 | None |
| T1GNZ5 | 4-303 | None |
| A0A5J4VK66 | 12-367 | None |
| A0A835R4S9 | 11-333 | None |
| A0A7C6Y895 | 143-470 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.