DPCstruct | MC4422
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 240 ± 56 aa |
| Standard deviation of domain lengths | 55.62 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 78.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B0G2L5 | 1-354 | MRLNLKAFLLFLTVIVMVITCAIYMRCVEFTFPQDLVKRWDRRLYVGNADLLHDQLDGSDNVRGGIAANDGFHLQELQDIDLHCKRD… |
| A0A7I8WRF7 | 184-429 | DVDCLIEGTRRIHCIKKGIEIYFPFNFIKKQFDVNGKWVTDTRFEYYTSYSKSKKPDMKNYSSFGSFGNFGSYNVEKRDRVGCIHGT… |
| A0A4E0RUN1 | 1-214 | None |
| A0A085MIP9 | 41-330 | None |
| A0A6J3C6G2 | 32-296 | None |
| A0A1A9UWJ1 | 1-252 | None |
| A0A0R3QET3 | 5-182 | None |
| A0A2R7WEF5 | 1-273 | None |
| W6UMI8 | 7-180 | None |
| A0A811X461 | 18-284 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.