DPCstruct | MC44219
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 251 ± 24 aa |
| Standard deviation of domain lengths | 23.84 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 21.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A067N0K2 | 1-212 | MTLLLNSINNKHGGYLTRRLHIPHEVWSQGGAKLMNLQEKGKCVAVLSSALEEVTAGSGEFFRGAGRVSAEKWARVLEDWNAVCEGV… |
| A0A067C485 | 10-293 | SPRSHGPHKLNLSAELLDKYSTLDATTYEAPPTGPLRVFGIMKLVQASISSGCFLTRQLYAPREIWLMDRVRLAGVDHKMRLLEVLS… |
| A0A662X2Y7 | 5-240 | None |
| A0A024GCD8 | 35-305 | None |
| A0A261Y7Y9 | 547-817 | None |
| D7G2C1 | 108-305 | None |
| A0A2P4QYD0 | 47-289 | None |
| A0A1Y2D8G6 | 61-331 | None |
| A0A238FMN4 | 872-1125 | None |
| A0A0W4ZNU7 | 423-664 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.