DPCstruct | MC44217
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 550 ± 12 aa |
| Standard deviation of domain lengths | 12.40 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 81.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 17.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08578 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A067BZZ6 | 1-542 | MLALWVLLLSHVDKISVLKYKYLCYRLLEALVQRDEFLLLHLDFDFNTMDVRKDGDRDAWRLVHLYRKLVGDTFVHASSLLLRNTLS… |
| M2ZXQ6 | 20-588 | HEKQLISPLSVSQKKDELWNQFRTLDADFSKFSSKSTSLKANVVRNALIPWLRTYANHPSNKTLRPEDLDRRTSILNKWWCGLIEML… |
| A0A3N4LDS9 | 126-681 | None |
| A0A7S3IBI7 | 1-559 | None |
| A0CD25 | 408-955 | None |
| J9HNQ2 | 456-982 | None |
| A0A1R2AYA0 | 338-886 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.