DPCstruct | MC44214
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 299 ± 25 aa |
| Standard deviation of domain lengths | 25.40 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 69.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 21.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14922 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6TYR4 | 1-269 | HMTGDVTERSADRTFVTAVNESSAFPSRVEPRGTRSEPAREVKNETKPITEFDVFRAEDAHAPLPDNPNLDDPNALCYPLPKTIPIQ… |
| C3YBN7 | 51-343 | TAYRTCTSSYNTCGMDEDGKTALSMGLLDQFEQRLDDLEIKLDQYAQHILDDEHRPSRLAEGLFHTPSDEIVEKNAAVQTHHSRRRK… |
| D7FSU1 | 50-329 | None |
| A0A834AVL6 | 2-350 | None |
| K1RXI6 | 34-340 | None |
| L1JUT5 | 95-390 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.