DPCstruct | MC44210
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 139 ± 13 aa |
| Standard deviation of domain lengths | 12.55 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 40.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A067BY71 | 151-287 | DKCSAENPQGCEKNGLMWYPKCQKGYHAFGCCICTPDCPAGTHDDGAFCRKDHYGRGAGASRLGCQAGQEKSGLMCYPPCADKYKGK… |
| A0A078A137 | 80-212 | SHEECYKDNKKTDCEKWGDLWYPKCKDSFHNVDCCVCSPDCVNGQIDIGVSCQKLTYGRGVGEPLGCSIDEEEQAALCYTPCKQGYN… |
| A0A397CLN4 | 103-257 | None |
| A0A485KJ15 | 234-348 | None |
| A0A7S1G8V2 | 65-211 | None |
| A0A6A4ZZF8 | 1-130 | None |
| A0A078BBM9 | 99-254 | None |
| A0A818VW82 | 1-138 | None |
| A0A836BT52 | 122-246 | None |
| A0A6C0IWA9 | 127-267 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.