DPCstruct | MC4421
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 100 ± 9 aa |
| Standard deviation of domain lengths | 9.00 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 39.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0529 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U9U829 | 48-137 | FILEFSIHLASSRFARELKSVFPQVEYIERCLVVPTFLKCTHDLVGIGAAIDNEKDEKLEDFVGWGKEICQKLRDRGYWADLTDPCS… |
| A0A183VGA6 | 1-112 | MQPKKDVAEKQPVSELKAGDVGEKTIELKAVNCPDSMKKKVGELFPNQNVDTLSVLNVTQKTKNDMSAWNANMEIEWMAVSSGFVDS… |
| A0A6B0S1Y9 | 355-445 | None |
| A0A0M3IE11 | 71-186 | None |
| A0A815VHV8 | 16-108 | None |
| A0A6A5D146 | 113-218 | None |
| A0A4U5M6W6 | 100-190 | None |
| A0A183J8E0 | 1-105 | None |
| A0A1I8FW69 | 7-103 | None |
| A0A3R7PNQ9 | 391-479 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.