DPCstruct | MC44205
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 187 ± 25 aa |
| Standard deviation of domain lengths | 24.64 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04026 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q6KTN7 | 111-286 | IQITRHELKTRKADVTITWGNNLKVEGLYVASRVRGGVRLSVPVYFVPGGGRMDLITVGQQLQAAVLRAYQQMEHEGKDQCRVSYLA… |
| W0U619 | 2-216 | KISVRTTHYTNDNSPQLRGYATVKFDDSYVLESVKIMERQDSNEIFIALPSLMVRTKDQNGNYVINDKGEYVKEFKEVFHPITAESR… |
| A0A3A5L976 | 11-213 | None |
| R7F4U9 | 220-430 | None |
| A0A7X8LTH1 | 1-185 | None |
| X1DM40 | 1-134 | None |
| A0A3D2KED7 | 24-227 | None |
| A0A1F6L9K7 | 97-261 | None |
| R6SBV6 | 2-183 | None |
| K1U628 | 1-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.