DPCstruct | MC44203
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 61 ± 3 aa |
| Standard deviation of domain lengths | 2.84 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 91.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 48.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q0QDL4 | 1-60 | MVDVVETETVPKPTVAGWFFVTKGDEREPIGMRIIETPTDVGRFVNRDARVRFTAYVPPR |
| A0A1Q7BFV2 | 5-63 | IRVVETDTVPRSYIGPGNKRLLHPDGGTEPLGNRIIEVPEDEEVVVYRDPTSGFVAYVP |
| A0A2V8L599 | 45-106 | None |
| A0A2V8MMS4 | 211-270 | None |
| A0A3N5NS81 | 98-157 | None |
| A0A2U3PVG2 | 23-90 | None |
| A0A523DD57 | 94-152 | None |
| A0A2V6UZB3 | 83-140 | None |
| A0A1H4K4D3 | 91-154 | None |
| A0A1I3CHE8 | 40-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.