DPCstruct | MC44202
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 191 ± 20 aa |
| Standard deviation of domain lengths | 20.01 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 37.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0515 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A537QBG0 | 153-369 | CGDDSREIAGLPIDQIQQIIQPNEAQREALDELANASAKAAKEIKGACPTQVSLTAPDRIAAMQQRIEAMISAVDTVQPALQKFYDL… |
| A0A1Q7BEC1 | 2-185 | AEAIERIAATCPAAVPASLAERLNAIQNRIWAMRDALLTIRLPLETFYTSLSDEQRQQLRQGEPQPAQMTADATVGRGQTDRSAPTC… |
| A0A1I7LFE4 | 256-428 | None |
| A0A537SSB1 | 350-567 | None |
| Q1QP41 | 119-308 | None |
| A0A109BEI3 | 194-359 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.