DPCstruct | MC44200
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 86 ± 6 aa |
| Standard deviation of domain lengths | 6.17 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 24.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02470 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A524Q6J1 | 6-85 | EAKVGLMIAICFTLFIVLVALLAKINVSRSGYTLRVYYGFLNDLRIGAPVKIAGGIRIGHVKSIAQTGEKTEVTVWIEKK |
| A0A855HT20 | 1-89 | MKSRTSELAVGIFVIIFGVALFFLAMKVSGLVGTNLNDSYHMTARFDNVNGLKSRAKVTMSGVTVGRVESITLDPVTRLATVDFDLD… |
| A0A7X8G0B0 | 1-84 | None |
| A0A7I7SL87 | 7-91 | None |
| A0A519N9R6 | 277-356 | None |
| X7ZV80 | 10-95 | None |
| A0A804KUC3 | 89-168 | None |
| A0A2N7QMY7 | 1-91 | None |
| A0A3M1FXB0 | 7-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.