DPCstruct | MC4420
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 155 ± 39 aa |
| Standard deviation of domain lengths | 39.23 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 85.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.31 |
| Pfam Score | 89.29 |
| Assigned Pfam label(s) | CL0277- PF04777 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9YY43 | 3-117 | DLESAVLYTLRMEAAVFPSLEGERLLALKDFLSVLVQYFAGRLVVKNYLYNLELWLRPKTTVLQSEWEEALKNKKEFPNATLPERPH… |
| A0A818SWJ2 | 3-123 | KLTIEDIDSAVIWMINKDLRRKLPNLTEDVKNWINTLYIYYPGSNTLQNFLYDLNIFLNNRTTLTSIELQNYINSTSIIKLPELKFD… |
| A0A0B2VSJ1 | 515-669 | None |
| A0A816C7U2 | 450-585 | None |
| J9E3X1 | 51-266 | None |
| A0A077YX42 | 699-845 | None |
| A0A0D8XVB3 | 147-383 | None |
| G1MVM9 | 169-309 | None |
| A0A819TRH3 | 19-146 | None |
| A0A504YJG2 | 70-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.