DPCstruct | MC442
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 135 ± 18 aa |
| Standard deviation of domain lengths | 18.38 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 93.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 40.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G5KAT6 | 119-266 | LTVAEETCTTCHQTGNSREIRVSRMSYDGSGNLNQGIRRDIDTNRQRLFVLITDYAREVAGTPLVYVNRHPYFFADHNGDGKPDQRE… |
| A0A126V2D9 | 27-162 | DFRAIRTTPLDILGDGNTTAGIGVVISQLHDQLNAAIMTYSQEIGGGAIVYSDVAYPYFFNDLDADGIADPTEIAFPNAYKSWTPRL… |
| A0A7V2ADM8 | 3-137 | None |
| A0A7C1K530 | 506-665 | None |
| A0A4P6V482 | 166-303 | None |
| A0A143BAR6 | 584-722 | None |
| A0A2R8BJK6 | 2-115 | None |
| A0A662DM78 | 13-136 | None |
| A0A359EEA5 | 86-227 | None |
| A0A3D0UL18 | 2-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.