DPCstruct | MC44196
Metacluster Properties and Pfam Annotations
| Number of structural domains | 91 |
|---|---|
| Mean domain length (aa) | 189 ± 26 aa |
| Standard deviation of domain lengths | 25.95 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 91.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 22.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0052 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A524PYL0 | 257-466 | SNNWALSGSKTKSGRPIVCNDTHLALLMPNAWFMLHQKCPSYEAAGITAPGLPLVALGYNGNVAWGATMVMADNQDIFVEKLKEIDG… |
| A0A7Y8B7N5 | 3-210 | AVAVGRDRSFNGRGMLLANPHFPWVGGMRFYEMHLTIPGQLDVMGAALPGLPVINIGFNQHVAWTHTVDTSKHFTLYRLTLDPKDPT… |
| A0A2N1V2R4 | 265-451 | None |
| A0A0K3ACB7 | 117-295 | None |
| A0A2E0XEL7 | 1-119 | None |
| A0A3E0P4L9 | 225-426 | None |
| A0A395LVL4 | 295-508 | None |
| A0A1Y5E4D7 | 324-517 | None |
| A0A2V7KEE5 | 494-705 | None |
| A0A6I7WLP2 | 91-266 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.