DPCstruct | MC44191
Metacluster Properties and Pfam Annotations
| Number of structural domains | 311 |
|---|---|
| Mean domain length (aa) | 137 ± 26 aa |
| Standard deviation of domain lengths | 25.89 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 88.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 19.31 |
| Pfam Score | 84.16 |
| Assigned Pfam label(s) | CL0032- CL0227- CL0202- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A243RUU6 | 5-132 | RAVRAAAYCVPTDQPEADGTLVWDATTLVVAEVDAEEIVGTGWAYAPAAAVSFITETLAAVATGADALDIPATWTAMVRQVRNAGRT… |
| A0A4U9CZ37 | 21-123 | TLIVEVEADSGQTGFAVTTAGEMGCFIVEKHLSRFVEGKCVSDIKLIHDRMLNATLFYSGSGGLVLNTISCIDLALWDLFGKVVGLP… |
| A0A0V0Q9N7 | 7-155 | None |
| A0A424L195 | 38-210 | None |
| A0A2V7YDK0 | 129-299 | None |
| A0A2V7Y948 | 211-350 | None |
| A0A7M3RN17 | 1-133 | None |
| A0A7C1MCZ2 | 66-226 | None |
| A0A135V828 | 21-140 | None |
| A0A1A9VKA2 | 1-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.