DPCstruct | MC44188
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 89 ± 4 aa |
| Standard deviation of domain lengths | 4.45 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 92.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 42.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0613 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A837Q2K7 | 1-91 | ALIDGMQMDLLRVRYGSFEELKLYCRRVAGVVGCLIARILGFSDDQTLEYADKMGLALQLTNIIRDVGEDARRGRIYLPMEEMRRFD… |
| A0A2T4RNU0 | 24-113 | LIDTVYKDQHFTMFETDADLFGYCYGVAGTVGEVLTPILCDHETHQTYDVARRLGDSLQLINILRDVGEDFENERIYFSKQRLKQYE… |
| A0A7J0D2B8 | 114-200 | None |
| A0A6V7PIM1 | 1037-1131 | None |
| A0A7C6LFD7 | 387-469 | None |
| A0A7W8HNV9 | 30-117 | None |
| A0A803KLW0 | 371-460 | None |
| A0A834WVH3 | 48-135 | None |
| A0A7J6F636 | 534-628 | None |
| A0A4Y9J933 | 39-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.