DPCstruct | MC44187
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 111 ± 6 aa |
| Standard deviation of domain lengths | 6.09 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 81.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 35.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A837Q2I5 | 1-110 | AGSVQSNSVAQAVQTSFGIEPAYTGITLTVLTAVVVLGGIKGIAKAASFIVPAMAVFYVLGGLSIIAINSDALMPAVKLIFSDAFSA… |
| A0A6L7E675 | 32-136 | VQSNSISGVMNSTFQIPTWITGIIITVFTALVILGGIKSIGRVTAIFVPVMALFYVICGLIILVMNADLVPSAVGLIFTDAFTGQAV… |
| A0A241TWL0 | 64-171 | None |
| A0A177IUB9 | 64-171 | None |
| A0A379WF87 | 29-141 | None |
| R5QK67 | 176-289 | None |
| A0A380EJX4 | 1-127 | None |
| A0A6V7RI02 | 51-152 | None |
| Q64CM4 | 71-179 | None |
| A0A2H0XT14 | 173-283 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.