DPCstruct | MC44182
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 196 ± 26 aa |
| Standard deviation of domain lengths | 26.44 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 23.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0592 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V3BT39 | 196-391 | AFAILKTAMYGELMRQTHLAPYFDAISFALNESGPGFDFSDTTSALKESFERDPARGLTDLFEFERAGGERLRAMGFDPYRLMRDWL… |
| A0A837PXZ8 | 8-186 | IVKVTNDTYDHLAKNIYQNLLFQTRLQPYLNQISFKMENDTFTLDFSGLVQAFNHVKETNPQKAFVDLAEMLAYGELRSWYEGRRLM… |
| A0A7T0JQF2 | 321-591 | None |
| A0A1C3H1X5 | 403-598 | None |
| A0A7I6ZCE3 | 821-989 | None |
| A0A378QWP5 | 1-259 | None |
| A0A6H9S8X3 | 582-753 | None |
| A0A060HDF4 | 331-530 | None |
| A0A4Y8JEB1 | 222-400 | None |
| A0A2T5R983 | 405-599 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.