DPCstruct | MC4418
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 355 ± 51 aa |
| Standard deviation of domain lengths | 50.57 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 23.93 |
| Pfam Score | 89.38 |
| Assigned Pfam label(s) | CL0010- PF17846 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183VDM1 | 21-409 | NHKRDYYNDKMKYENISKEELRQQAEGYIRAIQWNLHYYYHGCCSWNWFYPHHYAPYISDVVDFADMEMGFELSSPFHPFEQLMAVL… |
| A0A167R427 | 1-333 | MKFPFQLGTPFRPFEQLMGVMPEASKELLPMAYRDLMYDVSSPILDFYPQTFEQDMNGKKAEWEAVIKIPFIDQARLLAAMAPRERL… |
| G0QQF0 | 431-833 | None |
| A0A7S2W116 | 2-305 | None |
| D3BCJ3 | 2-304 | None |
| A0A7S1FGU1 | 2-264 | None |
| K3W9G5 | 326-657 | None |
| A0A7S3PKU7 | 215-582 | None |
| A0A0J9XMB0 | 316-647 | None |
| J9F8Q6 | 27-361 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.