DPCstruct | MC44178
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 107 ± 15 aa |
| Standard deviation of domain lengths | 14.91 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 48.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00082 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A445J0Q9 | 4-105 | VTAYSFTIERKYGVFSKLDACTFVVNVYNDGNVLSIVTDCSGHGTHVAGIATAFHPKEPLLNGIAPGAQIISCKIGDSRLGSMETGT… |
| A0A3Q1IHC8 | 219-326 | SECGDLSQCTVLCSYRERQEYATLGNAEMLNYSVNIYDEGNTLCIVTSGGAHGTHVASIASGYFPEEPERNGVAPGAQILALKIGDT… |
| A0A0N4TFC0 | 2-79 | None |
| A0A183B855 | 5-124 | None |
| A0A182EKP3 | 176-292 | None |
| A0A3L6VQH8 | 239-331 | None |
| A0A5K4F4K4 | 281-397 | None |
| A0A183NPQ1 | 1-115 | None |
| A0A438E2Q3 | 346-455 | None |
| A0A2G2X6T0 | 97-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.