DPCstruct | MC44177
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 105 ± 7 aa |
| Standard deviation of domain lengths | 6.87 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 40.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E7FG83 | 68-167 | DINKASYYYNPIIDVPGTEEERNKFPLSYPCNRWPKKESLPTFEQACKEFGSMMKTVAVELCSHIDTYAHSVNKSYPPQSLYETLAN… |
| A0A2C9U9D9 | 140-242 | DLFKGSFYANPVLDVPTTDAYLMHRYPHFCGSNIWPVNSLPELEVAFKALGKLILDVGLMVAYHCDKYATKGMKINENEGLEQILLR… |
| A0A364MXH3 | 102-207 | None |
| I4YEQ3 | 32-137 | None |
| A0A1V9Y953 | 107-209 | None |
| A0A0E0L5I5 | 253-357 | None |
| A0A452ZUI8 | 3-105 | None |
| A0A7S4BCQ1 | 100-201 | None |
| A0A7J7PUM0 | 96-197 | None |
| A0A813J6N4 | 195-299 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.