DPCstruct | MC44174
Metacluster Properties and Pfam Annotations
| Number of structural domains | 73 |
|---|---|
| Mean domain length (aa) | 112 ± 11 aa |
| Standard deviation of domain lengths | 11.28 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 33.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J0PQR5 | 247-363 | KGPEGFPSTGFDLHEKDKEYMATCKVVVSSCIFGSSDFLRRPTKSKIHTYSKKNVCLVMFLDELTLAKLSSEGQIPDDNGYIGLWRI… |
| A0A6I9QKY6 | 331-456 | CGFVRGPKGSPSTGFDMAEDDVRYMSRCHIAVSSCIFGKSDNLRTPYNKVVTRLSRKNVCFIMFMDEITLQTLLSEGQKIDNSGFIG… |
| A0A0E0K580 | 15-137 | None |
| A0A835RM77 | 36-146 | None |
| A0A1D6FTL0 | 63-162 | None |
| A0A820USK9 | 2-107 | None |
| A0A1X1Q721 | 136-230 | None |
| A0A6A6LB81 | 126-216 | None |
| A0A815SUD6 | 32-141 | None |
| A0A6P6GC23 | 235-355 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.