DPCstruct | MC44173
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 140 ± 16 aa |
| Standard deviation of domain lengths | 16.40 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 63.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.63 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 30.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J0PMK6 | 7-162 | TSNQQNLKKELIMHLKNQGQVEAFLDHDTGHKSPSPQTSEKHCESRRQDAAVGEACHPQGTVGDQGWNDASPGKNLKYRSRSKRYSN… |
| W1NGC1 | 190-319 | IEFEHIESNHVDTDSVVPVPFKTRKCDKLPKNDLESQDQGQQSAGSRKYALRHRPFEHCTESAEPSKRRKIGPWTAKEEEVLKEGVK… |
| A0A0A9VS24 | 57-211 | None |
| A0A068UCC5 | 17-152 | None |
| A0A2N9I932 | 168-291 | None |
| A0A0A9NEY3 | 3-150 | None |
| A0A0D3CAQ1 | 128-268 | None |
| A0A6P5GYE4 | 45-181 | None |
| A0A453Q0V1 | 12-181 | None |
| A0A6S7PKH1 | 90-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.