DPCstruct | MC44172
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 317 ± 58 aa |
| Standard deviation of domain lengths | 57.94 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 70.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 32.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J0PI71 | 36-342 | LPSPYGKLGCALLDPELRETAYEIFVAACRSTGGKPLTFISQSERTPPSADRSLSSPASSSSSSSLQRSLTSTAASKMKKALGIKSS… |
| A0A287P6Z6 | 1-306 | STSSSGLQRSRTSTAASRVKRSLGLSPSASSKAGTAAPRRPETVMELVRVNLRVTEQADSRIRRGLLRIAAGQLGRRAESMILPLEF… |
| A0A2I0XIM3 | 29-356 | None |
| A0A446LBV5 | 119-404 | None |
| A0A7J7LCM6 | 137-418 | None |
| A0A2T7CYW2 | 99-449 | None |
| A0A835UGW1 | 62-404 | None |
| A0A2R6WZN0 | 27-293 | None |
| A0A835RNV4 | 309-569 | None |
| A0A446MKJ1 | 4-277 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.