DPCstruct | MC44168
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 57 ± 5 aa |
| Standard deviation of domain lengths | 5.17 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 40.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02547 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C9AWE4 | 1-55 | MKTSDFNFELPEELIAQHPLADRSASRLMVLNRQKRTIKHEVFINILDHLHKGDV |
| A0A0D0S4Y4 | 1-55 | MNVKDFDYELPERLIAQDPLEDRSSSRLLVLDKKTGQRTHTHFREITSYLKKVIA |
| A0A136K7V2 | 1-57 | None |
| A0A6L8QBD0 | 29-91 | None |
| X1BFT6 | 25-72 | None |
| A0A7C2PTT2 | 2-52 | None |
| A0A7V3ALT8 | 1-56 | None |
| A0A0F8WCE1 | 1-48 | None |
| N1TZJ7 | 3-60 | None |
| A0A523MDN8 | 11-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.