DPCstruct | MC44166
Metacluster Properties and Pfam Annotations
| Number of structural domains | 91 |
|---|---|
| Mean domain length (aa) | 189 ± 34 aa |
| Standard deviation of domain lengths | 34.24 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.63 |
| Pfam Score | 85.30 |
| Assigned Pfam label(s) | CL0020- PF20422 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B0EMH8 | 46-204 | TNKFISEIPIIKTKDNKNITIKDIWKKKLYITTEHPLPSELIRQKVLHIEEYLCTPIECCIDDVIKKKKQLTSQFIISNQRNTPTMT… |
| A0A0S7GAZ3 | 2-127 | YCTPFTLDGRAHGDLHEQYKRKTILTTSHAFPYIKTRVNVIHKEEIILVPIEVAIEDMQKKTQELAFATNQDPADPKMLQMVLQGCV… |
| K7HXX5 | 392-608 | None |
| A0A5N4CYX9 | 409-611 | None |
| A0A7R9ZNV7 | 2-174 | None |
| A0A836DAY9 | 843-1053 | None |
| K3X541 | 471-667 | None |
| A0A6V7PEK0 | 243-421 | None |
| F4PY03 | 121-323 | None |
| F4PSQ6 | 59-282 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.