DPCstruct | MC44162
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 127 ± 15 aa |
| Standard deviation of domain lengths | 14.60 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 89.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 23.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A1UEX9 | 46-167 | VDVIGLAETQAKQLLQATKHTQISVKEKSLQRRIKKNITYFTQNLLIDFCIEHGYFFNSIYSKKSQKTFQVERVQEIFFGSTFLMRK… |
| A0A0A1TY63 | 61-185 | LGFGQKIEEYCASQYLRDSEGAKTQNEIKVAKRRKDLNRSALSFNWLVKYVEQYGYILTRRPTKIPKKTLQMEKITGIGTDHECIFN… |
| M3TJ58 | 87-207 | None |
| K2HIV6 | 249-374 | None |
| B0EJ72 | 1-116 | None |
| B0E686 | 68-223 | None |
| A0A0A1TZJ1 | 137-277 | None |
| A0A0A1U832 | 81-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.