DPCstruct | MC44160
Metacluster Properties and Pfam Annotations
| Number of structural domains | 406 |
|---|---|
| Mean domain length (aa) | 120 ± 27 aa |
| Standard deviation of domain lengths | 26.72 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 81.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 17.64 |
| Pfam Score | 94.45 |
| Assigned Pfam label(s) | CL0101- CL0534- CL0267- PF04296- CL0179 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B0E9L8 | 5-125 | NQTPQEIQELPQELKDIKAVLYQARAQNILTKGIRQCLKVIEAKKALFCFIAEDCDNDKYTGLLTAICKEQGIKIVKVPEKIQLGEW… |
| A0A1C5PZE4 | 4-99 | LIESITFCKRIGALTLGFDPVRESMEQGNAKLVLLASDLSPKTRKEVAYLCGRYAVKSLPTPFTLDEFWYLVGKRAGIIAVTQEAFA… |
| A0A0C2MH73 | 23-119 | None |
| A0A034VJ88 | 1-173 | None |
| R9P6E8 | 5-114 | None |
| A0A1A8YLH2 | 150-290 | None |
| A0A7R9PQ56 | 54-200 | None |
| A0A5J5UXL7 | 1-90 | None |
| A0A5S6QH19 | 89-217 | None |
| A0A7R9KHP5 | 829-944 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.