DPCstruct | MC4416
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 75 ± 11 aa |
| Standard deviation of domain lengths | 11.03 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 39.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05811 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G7YEL9 | 2-66 | TKLDKEFLRKMQATYFRCGLQCAENSDISVMDVQRCIERCESPLSQAQNLMQSELSSFQNRVQQC |
| A0A183VB69 | 5-80 | QKRMKTAVDAMIDEIDRKYLRDVQKKMFVCSSKCCDDKSLSREDVESCVDRCNTTMKGAQMTLEKELGELQVHLRS |
| A0A0R4IFR2 | 3-74 | None |
| A0A1A6HSS7 | 1-57 | None |
| A0A183WLW6 | 2-76 | None |
| A0A0R3TLJ3 | 11-91 | None |
| A0A2A6CHH0 | 30-102 | None |
| H2YH95 | 1-72 | None |
| A0A2T7PAK9 | 1-75 | None |
| F0WG07 | 465-574 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.