DPCstruct | MC44155
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 373 ± 35 aa |
| Standard deviation of domain lengths | 34.51 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 74.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 16.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A554V6M6 | 1-407 | MSIDSAAESAKVAGQRATVDSVKVTLGDHEQPKQPITLTFDLSNDPDFYRQISDSVRPLIALDPVKGSPTDYLAPHWDSSAKTLTAR… |
| A0A1H2JSM2 | 78-446 | AEGSDEAGKSVIPLAGADLTLSTGQPTAPLTFRYELDEPLPEGTDLYLLGRESGASDSVVPATPIAAAIDSNRRVATAQVPHLSTWE… |
| A0A0Q9M7U9 | 3-335 | None |
| A0A7T5RV41 | 96-512 | None |
| A0A5A7WHZ4 | 90-437 | None |
| C8XHC3 | 459-865 | None |
| A0A1H9W9N8 | 57-386 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.