DPCstruct | MC44152
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 114 ± 15 aa |
| Standard deviation of domain lengths | 14.80 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M1W9E5 | 7-115 | TDHALTLCIKKLSNDWEKKSRMRFSGAKPIMQLVGYPLVFSDENPERQITIRKEEPQITVIKTTSGFKIESNVDTNKIEGNYMVKRE… |
| A0A3D0ENC5 | 3-109 | QDRQVAKPITSQYHYYGSDRYEVDANTALPLLAGHPAVFWRDAPDVRIDIESVQIQLSITEKHDQLCLRLSPSFDSRDQVVMVNETP… |
| A0A1V1P3W0 | 251-363 | None |
| A0A844MWB9 | 337-460 | None |
| A8U1K6 | 91-199 | None |
| A0A1V1P7I1 | 544-655 | None |
| A0A2K8T876 | 1-94 | None |
| A0A6S5INQ9 | 352-461 | None |
| A0A060UTZ2 | 1-158 | None |
| Q1NQJ7 | 47-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.