DPCstruct | MC44151
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 189 ± 15 aa |
| Standard deviation of domain lengths | 15.41 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 78.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 19.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V6KBA3 | 66-237 | MPKTSNFKVINYNYKLAKAESKIAEEMVAVSLGMRQEYVKIEAEGKSLMSANLEGSDAEISETLKAKLEDLKTDKAQLSESQKVYFL… |
| A0A160N3R7 | 1-181 | MTSDALVTSFIQSNTQILTAQKFLALAYDQKDKAALLESEAKAIQSDGVGADELKKAVELSQKTNEELAAKQAEKAKLSEQEKQYYV… |
| A0A2E5N0C4 | 24-214 | None |
| A0A3D2L341 | 1-224 | None |
| A0A424SUT9 | 113-294 | None |
| A0A2E3ZUV2 | 358-542 | None |
| A0A2E3ZUV3 | 186-370 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.