DPCstruct | MC44149
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 74 ± 4 aa |
| Standard deviation of domain lengths | 4.38 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 79.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 50.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J5W9B8 | 2-73 | FDIDRILRPGGLFWLDNFYCSNEEKKRDLTRLIERFGYKKLKWVVGDKVDAAGSGKSEVYLSAVLQKPVRAL |
| A0A843W8N4 | 199-274 | MEFLLYDADRVLRAGGLLWLDHFFCRPLDLDAVYTPMIGKLGYRTSKWTVGNKTDSSGVRNGEVYLTALLQKPVGN |
| A0A5N5F3Y6 | 257-332 | None |
| A0A397XYY0 | 116-185 | None |
| A0A445EEC1 | 1-78 | None |
| A0A6V7PI04 | 300-373 | None |
| A0A4S4D255 | 235-305 | None |
| A0A835HMN6 | 73-145 | None |
| A0A843WVR3 | 2-76 | None |
| A0A6A6MQ10 | 76-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.