DPCstruct | MC44148
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 186 ± 17 aa |
| Standard deviation of domain lengths | 16.56 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 31.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0662 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A452XC80 | 115-279 | MEVFSPRPKNLQNYLLNRILVYVYREFRARERPGVLSQIRADEIPIEHPLTEVIVRKGLKHCADLEKGPNGHLFWTQRADFRIPSED… |
| A0A6J5W921 | 1-191 | MEVMSPGTKNLQTYMINRLLVYMCREFRAAEKRHFLPCIRADELPSQFPYLSEAFLRKKLKEHANLQALSFCSRGSNGQWMWVKKRN… |
| M0YM02 | 572-736 | None |
| A0A4Z2AYJ9 | 527-731 | None |
| A0A0G4KYW5 | 105-285 | None |
| A0A2T9Y050 | 622-821 | None |
| M5BSV7 | 469-648 | None |
| A0A1D2MEU3 | 429-646 | None |
| A0A1Y2W5L0 | 602-774 | None |
| A0A4P9W7X5 | 174-354 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.