DPCstruct | MC44142
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 63 ± 5 aa |
| Standard deviation of domain lengths | 4.76 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 34.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q7KQV4 | 4-67 | KSRLYFIWVTSMRGRVDHAVTDEEMVAGMADVRNEYEALCGVRFVPAPMICGPRRTCRVCAGRV |
| A0A4D4J6U8 | 1-62 | MNDFTWFSSQTDGQDHAVLDVAFAEARARGIDYAGLCGHVVWPAPLWAPPGRRCARCTAITA |
| A0A2W6CV92 | 1-56 | None |
| A0A1Q9ST30 | 1-57 | None |
| A0A1Q9SRJ4 | 7-65 | None |
| A0A4R2QY65 | 13-76 | None |
| A0A1Q9S1N0 | 1-60 | None |
| A0A1I5GVB9 | 1-64 | None |
| A0A1Y2MRE9 | 34-92 | None |
| A0A1Q4D687 | 1-61 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.